Skip to content
  • Each boxes of peptides contain 10 vials ...
  • Each boxes of peptides contain 10 vials ...
Wuhan Top Miracle PeptidesWuhan Top Miracle Peptides
    • Contact
    • 24 \ 24
    • +00 000 00 000
    • WhatsApp
  • Cart / €0.00 0
    • No products in the cart.

      Return to shop

  • 0
    Cart
  • HOME
  • SHOP
  • BULK ORDERS
  • SHIPPING & RETURNS
  • PRIVACY POLICY
  • FAQS
  • ABOUT US
  • REVIEWS
  • BLOG
  • CONTACT US
Tesamorelin UK professional enquiry from Wuhan Top Miracle Peptides
Home / Peptides

Tesamorelin

  • Tesamorelin & CJC-1295 & Ipamorelin Blend 12mg
  • TB-500 (Thymosin Beta 4) UK professional enquiry from Wuhan Top Miracle Peptides

€40.00 – €75.00Price range: €40.00 through €75.00

Clear
SKU: N/A Category: Peptides Tags: Buy Tesamorelin online UK, Cheap Tesamorelin UK, COA peptide supplier UK, Europe peptide supplier, GHRH analogue peptide UK, GRF analogue peptide UK, Peptide Purity, peptide purity UK, peptides for sale UK, professional peptide enquiry UK, professional peptide supplier UK, research peptides Europe, research-grade Tesamorelin, Tesamorelin, Tesamorelin batch documentation, Tesamorelin before and after, Tesamorelin dosage, Tesamorelin for anti-ageing, Tesamorelin for belly fat, Tesamorelin for bodybuilding, Tesamorelin for fat loss, Tesamorelin for growth hormone, Tesamorelin injection guide, Tesamorelin no prescription, Tesamorelin peptide UK, Tesamorelin Peptides, Tesamorelin professional enquiry, Tesamorelin supplier UK, Tesamorelin treatment UK, Tesamorelin weight loss, UK peptide supplier, where to buy peptides in UK, Wholesale Peptides, wholesale peptides UK
  • Tesamorelin & CJC-1295 & Ipamorelin Blend 12mg
  • TB-500 (Thymosin Beta 4) UK professional enquiry from Wuhan Top Miracle Peptides
  • Description
  • Additional information
  • Reviews (0)

Tesamorelin Research Peptide: A GHRH Analog for GH Axis & IGF‑1 Studies

If your research explores the growth hormone (GH) axis, pituitary function, or the metabolic effects of GH and insulin‑like growth factor 1 (IGF‑1), Tesamorelin research peptide offers a precisely defined and well‑characterised synthetic tool. Tesamorelin is a 44‑amino‑acid synthetic analogue of human growth hormone‑releasing hormone (GHRH), also known as growth hormone‑releasing factor (GRF). It was engineered to mimic the action of natural GHRH, binding to GHRH receptors on pituitary somatotroph cells to stimulate the synthesis and pulsatile release of endogenous growth hormone. This physiological mechanism of action distinguishes it from direct GH replacement therapies, making  research peptide a valuable tool for laboratories investigating the hypothalamic‑pituitary‑somatotropic axis, IGF‑1 signalling, and metabolic regulation.

At Wuhan Top Miracle Peptides, we supply high‑purity Tesamorelin research peptide to research institutions and wholesale buyers across the United Kingdom, France, Germany, Spain, Sweden, Italy, and the USA. Every batch is lyophilised, HPLC‑verified to ≥98% purity, and accompanied by a Certificate of Analysis (COA), ensuring your investigations into GH physiology, GHRH receptor pharmacology, and metabolic research begin with uncompromising quality.

What Is Tesamorelin and How Does It Work?

To fully appreciate the research potential of Tesamorelin research peptide, it is essential to understand its biochemical design and the precise mechanism by which it modulates the GH axis.

The 44‑Amino‑Acid GHRH Analogue

Tesamorelin is a synthetic 44‑amino‑acid polypeptide that corresponds to the full sequence of human GHRH with a specific modification at the N‑terminus. It comprises the same 44‑amino‑acid chain as human GHRH but includes a trans‑3‑hexenoyl group at the N‑terminus. This structural modification enhances resistance to enzymatic degradation, improving its stability and pharmacokinetic properties. Its molecular formula is C₂₂₁H₃₆₆N₇₂O₆₇S, and its molecular weight is approximately 5135.78 g/mol. It has a CAS number of 218949‑48‑5.

Mechanism of Action: Physiological GH Stimulation

The biological activity of Tesamorelin research peptide is rooted in its ability to mimic the body’s natural GHRH:

  • Receptor Binding: Tesamorelin binds to and stimulates human GHRH receptors with potency similar to the endogenous hormone.

  • Signal Transduction: This receptor activation triggers intracellular signalling cascades in pituitary somatotroph cells, stimulating both the synthesis and pulsatile release of endogenous growth hormone.

  • Physiological GH Release: The peptide promotes the natural, pulsatile release pattern of GH, preserving the body’s intrinsic regulatory feedback mechanisms.

  • IGF‑1 Elevation: The released GH then signals the liver (and other target cells including chondrocytes, osteoblasts, myocytes, and adipocytes) to produce IGF‑1, the primary mediator of many of GH’s anabolic and metabolic effects. Tesamorelin subsequently increases IGF‑1 and IGFBP‑3 levels.

Clinical Context and Research Value

Understanding Tesamorelin’s clinical backdrop is essential for any laboratory study. It received FDA approval in 2010 for the reduction of excess abdominal fat in adults with HIV‑associated lipodystrophy and remains the only FDA‑approved medication for this indication. A new, more concentrated formulation (Egrifta WR) was approved in 2025. This clinical use has produced well‑documented pharmacokinetic and pharmacodynamic data that can inform research protocols. Following subcutaneous injection, Tesamorelin reaches peak plasma concentration within 15 minutes and has a plasma elimination half‑life of roughly 26 to 38 minutes.

Key Research Applications

Tesamorelin research peptide is a versatile tool with applications spanning several domains of endocrinological and metabolic research.

Growth Hormone Axis & Pituitary Function Studies

The most established application of Tesamorelin is as a research tool for investigating the hypothalamic‑pituitary‑somatotropic axis. It is a well‑characterised GHRH agonist for studying GH secretion dynamics. Researchers use it to investigate the effects of GHRH receptor activation on somatotroph cell signalling and gene expression. As a GHRH agonist, it restores normal GH pulsatility and amplitude, offering a more physiological means of studying GH regulation compared to direct GH administration.

Metabolic & Body Composition Research

By stimulating endogenous GH release, Tesamorelin provides a model for studying the downstream metabolic effects of GH and IGF‑1 elevation. Research has demonstrated that Tesamorelin reduces visceral adipose tissue (VAT), decreases cholesterol and LDL, and reduces triglycerides. It is also being investigated for its effects on hepatic fat, with studies exploring its potential to decrease liver fat and improve liver inflammation and scarring in individuals with non‑alcoholic fatty liver disease (NAFLD).

Cognitive & Neurodegenerative Research

Emerging research suggests that enhancing circulating IGF‑1 levels through GHRH administration may have implications for cognitive function. Studies have investigated the effects of Tesamorelin on neurocognitive impairment in persons with HIV and abdominal obesity. The GHRH agonist Tesamorelin has been reported to improve cognitive function in older persons, making it a tool for investigating the role of the GH/IGF‑1 axis in neuroprotection and cognitive health.

 Cardiovascular & Metabolic Health Research

Tesamorelin has been studied for its effects on cardiovascular risk markers. Research indicates that it reduces intima media thickness and improves fat quality independent of changes in fat quantity. These findings position Tesamorelin as a valuable tool for studying the relationship between GH, lipid metabolism, and cardiovascular health.

 Age‑Related GH Decline (Somatopause) Research

The age‑related decline in GH and IGF‑1 levels is a significant area of research. The GHRH agonist Tesamorelin restores normal GH pulsatility and amplitude, providing a tool for modelling and investigating interventions that may modulate this decline.

Chemical & Physical Specifications

Accurate characterisation of Tesamorelin research peptide is essential for reproducible experimental design.

Parameter Specification
Common Names Tesamorelin, Egrifta, TH9507
Amino Acid Sequence N‑hexanoyl‑YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL‑OH
Molecular Formula C₂₂₁H₃₆₆N₇₂O₆₇S
Molecular Weight ~5135.78 g/mol
CAS Number 218949‑48‑5
Purity ≥98% (HPLC verified)
Appearance White to off‑white lyophilised powder
Solubility Soluble in distilled water (up to ~2 mg/ml)
Storage (Lyophilised) –20°C, sealed, protected from light; stable for up to 2 years
Storage (Reconstituted) 2‑8°C for short‑term use; single‑use aliquots at –20°C for long‑term storage

Reconstitution & Handling Protocol for Tesamorelin

Proper reconstitution of Tesamorelin research peptide is critical for maintaining its structural integrity and biological activity.

Step 1 – Preparation

  • Bring the sealed Tesamorelin vial and your chosen diluent (sterile water for injection or sterile bacteriostatic water) to room temperature.

  • Clean your work surface with 70% ethanol and lay out sterile syringes, alcohol wipes and a clean work mat.

Step 2 – Vial Sanitisation

  • Wipe the rubber stopper of the Tesamorelin vial with a fresh 70% ethanol wipe. Allow the alcohol to evaporate completely before piercing.

Step 3 – Reconstitution

  • Draw your desired volume of diluent into a sterile syringe. A common research concentration is 1‑2 mg per 1‑2 mL of diluent.

  • Insert the needle and slowly inject the diluent against the inner glass wall. Do not spray directly onto the lyophilised powder.

  • Gently roll the vial between the hands for approximately 30 seconds to ensure reconstitution into a clear, colourless solution. Do not shake vigorously, as shaking can cause denaturation.

Step 4 – Aliquoting & Storage

  • Immediately after dissolution, aliquot the reconstituted Tesamorelin into single‑use sterile vials.

  • Store aliquots at –20°C. Avoid repeated freeze‑thaw cycles.

  • Once thawed, store at 2‑8°C and use within a short period.

Concentration Reference Table

Vial Mass Diluent Volume Final Concentration
1 mg 1.0 mL 1 mg/mL
2 mg 1.0 mL 2 mg/mL
5 mg 2.5 mL 2 mg/mL

Adjust diluent volume based on your experimental requirements.

Storage & Stability Guidelines

Storage Condition Shelf Life Notes
Lyophilised at –20°C, unopened 2 years Use desiccant, protect from light. The product is hygroscopic.
Lyophilised at 2‑8°C, unopened 6‑12 months –20°C storage is strongly preferred for long‑term stability.
Reconstituted at 2‑8°C Short‑term use Use within days to weeks.
Reconstituted aliquots at –20°C Up to 6 months In solution; avoid repeated freeze‑thaw cycles.

Why Choose Wuhan Top Miracle Peptides for Tesamorelin?

As an authentic licensed peptide supplier based in the United Kingdom, we supply  research peptide and a wide range of research‑grade compounds under rigorous quality assurance protocols, fully aligned with Google’s E‑E‑A‑T standards (Experience, Expertise, Authoritativeness, Trustworthiness).

  • Verified Purity: Independent HPLC analysis with purity guaranteed ≥98% for every batch.

  • GMP‑Compliant Manufacturing: All peptides are synthesised in ISO 13485:2016 and GMP‑certified facilities, ensuring batch‑to‑batch consistency.

  • Full Traceability: Batch‑specific Certificates of Analysis (COA) are available for every order.

  • Wholesale Supply: We serve research institutions, laboratories, and wholesale buyers across the UK, EU, and USA with flexible volume pricing and reliable logistics.

  • UK‑Based Regulatory Compliance: All products are supplied strictly as research‑grade chemicals for laboratory use only (RUO).

Researchers across the United Kingdom—including those at leading institutions in London, Cambridge, Oxford, Manchester, and Edinburgh—trust us for fast domestic delivery, transparent documentation and professional technical support.

FAQ: Tesamorelin Research Peptide

What is Tesamorelin research peptide?
Tesamorelin is a synthetic 44‑amino‑acid analogue of human growth hormone‑releasing hormone (GHRH) with an N‑terminal trans‑3‑hexenoyl modification that enhances stability. It binds to GHRH receptors on pituitary somatotroph cells, stimulating endogenous GH secretion and subsequent IGF‑1 production.

What is the sequence and molecular weight of Tesamorelin?
The sequence is N‑hexanoyl‑YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL‑OH. Its molecular weight is approximately 5135.78 g/mol.

What are the primary research applications for Tesamorelin?
Tesamorelin is used in growth hormone axis and pituitary function studies, metabolic and body composition research (VAT reduction, hepatic fat), cognitive and neurodegenerative research, cardiovascular and metabolic health research, and age‑related GH decline (somatopause) research.

 What is the mechanism of action of Tesamorelin?
Tesamorelin binds to and stimulates human GHRH receptors with potency similar to the endogenous hormone, triggering GH synthesis and pulsatile release from the pituitary, which in turn increases IGF‑1 and IGFBP‑3 levels.

 What purity does your Tesamorelin research peptide meet?
Our Tesamorelin is tested to ≥98% purity by HPLC. A Certificate of Analysis (COA) is supplied with every order.

How should I reconstitute Tesamorelin research peptide?
Reconstitute with sterile water for injection or sterile bacteriostatic water. Allow the vial to reach room temperature, then slowly inject the diluent against the inner glass wall and gently roll the vial between the hands for approximately 30 seconds. Do not shake.

 How should I store reconstituted Tesamorelin?
Reconstituted Tesamorelin should be stored at 2‑8°C for short‑term use. For longer storage, aliquot immediately into single‑use vials and store at –20°C. Avoid repeated freeze‑thaw cycles.

Is Tesamorelin research peptide legal to purchase in the UK?
Yes. Tesamorelin is a laboratory reagent sold for research use only (RUO). It is fully legal to purchase, possess, and use in the United Kingdom for legitimate in‑vitro or in‑vivo scientific research, provided it is not marketed with therapeutic claims.

Does Wuhan Top Miracle Peptides ship internationally?
Yes. We ship across the EU (France, Germany, Spain, Sweden, Italy) and to the USA from our UK warehouse. Wholesale pricing is available for bulk orders.

Wholesale Tesamorelin Supply Across the UK and Europe

Wuhan Top Miracle Peptides supports wholesale peptide buyers in the United Kingdom and international markets.

We Support Enquiries From:

  • United Kingdom
  • France
  • Germany
  • Spain
  • Sweden
  • Italy
  • USA
  • Wider Europe

For larger Tesamorelin enquiries, contact our team before ordering. This helps confirm stock, documentation, shipping options, and buyer verification requirements.

Where to Source Tesamorelin in the UK

If you are searching for where to source Tesamorelin in the UK, Wuhan Top Miracle Peptides provides a simple professional enquiry process.

Professional Enquiry Process

  1. Review the Tesamorelin product details.
  2. Contact our team for availability.
  3. Ask about COA and purity-related documentation.
  4. Confirm your shipping country.
  5. Discuss wholesale quantity requirements.
  6. Complete buyer verification where required.

 

Bulk Peptides Page
Shipping & Returns Page
Contact Us Page
Shop Page
Quality / Compliance Page
MedlinePlus / National Library of Medicine
PubChem / NCBI reference information
GOV.UK / MHRA
Google Search Central
ASA / CAP Code Section 12

From its design as a stabilised analogue of endogenous GHRH to its well‑documented role in restoring physiological GH pulsatility and elevating IGF‑1 levels, research peptide provides a precisely defined platform for advanced endocrinological and metabolic research. Its ability to stimulate endogenous GH release through the physiological GHRH receptor pathway—supported by FDA approval, extensive clinical data, and peer‑reviewed studies published in PubMed and other authoritative journals—makes it a valuable addition to any laboratory investigating the GH/IGF‑1 axis. By choosing high‑purity, lab‑verified research peptide from Wuhan Top Miracle Peptides, you ensure that your research is built on a foundation of quality, reproducibility, and scientific integrity.

Ready to advance your research  Browse our product catalogue, request a wholesale quote, or contact our support team today to discuss your laboratory’s specific needs. Place your order now and receive GMP‑grade Tesamorelin delivered directly to your facility in the UK, EU, or USA.

Tesamorelin

5mg, 10mg

Reviews

There are no reviews yet.

Be the first to review “Tesamorelin” Cancel reply

Related products

BPC-157 & TB-500 & GHK-Cu Blend wholesale peptide blend supply UK
Quick View

Peptides

BPC-157 & TB-500 & GHK-Cu Blend

€220.00
Add to cart
CJC-1295 & GHRP-6 Blend (10mg) UK professional enquiry from Wuhan Top Miracle Peptides
Quick View

Peptides

CJC-1295 & GHRP-6 Blend (10mg)

€60.00
Add to cart
GHK-CU
Quick View

Peptides

GHK-CU

€30.00 – €60.00Price range: €30.00 through €60.00
Select options
This product has multiple variants. The options may be chosen on the product page
B7-33 (6mg) UK professional enquiry from Wuhan Top Miracle Peptides
Quick View

Peptides

B7-33 (6mg)

€50.00
Add to cart
Sale!
5-Amino-1MQ
Quick View

Peptides

5-Amino-1MQ

€60.00 Original price was: €60.00.€55.00Current price is: €55.00.
Add to cart
Acetyl Hexapeptide-3 (Argireline) peptide documentation support for UK and Europe buyers
Quick View

Mini Insulin Fridges

Acetyl Hexapeptide-3 (Argireline)

€195.00
Add to cart
CJC-1295 (Mod GRF 1-29) & Hexarelin Blend (10mg) documentation support for UK and Europe buyers
Quick View

Peptides

CJC-1295 (Mod GRF 1-29) & Hexarelin Blend (10mg)

€75.00
Add to cart
Sale!
AICAR (50mg)
Quick View

Peptides

AICAR (50mg)

€62.00 Original price was: €62.00.€50.00Current price is: €50.00.
Add to cart
About Us

We are Wuhan Top Miracle Peptides, a fully licensed and UK‑based wholesaler of high‑purity research peptides. From our hub in the United Kingdom, we serve laboratories, research institutions, and biotech companies across Europe – including Spain, Germany, France, Ireland, and beyond.

Recent Posts
  • Buy KLOW
  • Buy GHK-CU
  • BPC-157 & TB-500 & GHK-Cu Blend
  • Buy BPC + TB
  • where to buy peptides in uk
Contact Info

Visit Wuhan Top Miracle Peptides today to contact our team, request wholesale information, and learn more about our peptide supply services across Europe.

info@wuhantopmiraclepeptides.com

https://wuhantopmiraclepeptides

whatsapp  447735045662

 

Copyright 2026 © wuhan top miracle peptides
  • HOME
  • SHOP
  • BULK ORDERS
  • SHIPPING & RETURNS
  • PRIVACY POLICY
  • FAQS
  • ABOUT US
  • REVIEWS
  • BLOG
  • CONTACT US
  • Login
  • Newsletter

Login

Lost your password?

WhatsApp us