HGH 191AA Somatropin – Recombinant Human Growth Hormone for Endocrine Research
HGH 191AA Somatropin is a recombinant human growth hormone (rhGH) that consists of a single, non‑glycosylated polypeptide chain of 191 amino acids with a molecular weight of approximately 22 kDa. It is produced in E. coli using recombinant DNA technology, yielding a product with an amino acid sequence identical to that of pituitary‑derived human growth hormone. As a member of the somatotropin family, Somatropin functions as a key regulator of the growth hormone/insulin‑like growth factor‑1 (GH/IGF‑1) axis, binding to the growth hormone receptor (GHR) to activate intracellular signalling cascades that influence cellular metabolism, proliferation, and differentiation.
If your research involves the study of the somatotropic axis, cellular proliferation models, metabolic pathways, or endocrine signalling, you need a consistent, high‑purity source. Our wholesale service provides academic and private labs across the UK, Europe, and the USA with top‑grade peptides for sale, including HGH 191AA Somatropin, all backed by transparent Certificates of Analysis (COAs). All products are supplied strictly for laboratory research use only under appropriate Home Office and MHRA licensing.
Why Your Research Demands High‑Purity Peptides for Sale
The reliability of your experimental results hinges directly on the quality of your research materials. Our HGH 191AA Somatropin delivers:
-
Verified Purity: Every batch undergoes rigorous HPLC and mass spectrometry testing to guarantee ≥98% purity, essential for reproducible results in sensitive endocrine assays.
-
Research‑Use Only: Exclusively for in‑vitro and laboratory applications. We never market it for human or veterinary consumption.
-
Lyophilised Powder: Supplied as a stable, sterile, freeze‑dried solid, ready for precise reconstitution according to your laboratory protocols.
-
Complete Traceability: A batch‑specific Certificate of Analysis (COA) accompanies every order, verifying identity, purity, and analytical test results.
Choosing a supplier that prioritises peptide purity is fundamental for scientific integrity. Our third‑party verification ensures you can focus on your research, not on quality concerns.
Scientific Background – Understanding HGH 191AA Somatropin
HGH 191AA Somatropin is the recombinant form of human growth hormone, a 191‑amino acid polypeptide with two intrachain disulfide bridges (C53‑C165 and C182‑C189) that stabilise its three‑dimensional structure. It is produced in E. coli and purified by proprietary chromatographic techniques.
Key documented research properties include:
-
Primary Amino Acid Sequence: The complete 191‑amino acid sequence is: FPTIPLSRLFDNAMLRAHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF. Its molecular weight is approximately 22,125 daltons.
-
Growth Hormone Receptor (GHR) Binding: Somatropin binds to the GHR dimer on target cells, inducing a conformational change that activates Janus Kinase 2 (JAK2) and leads to phosphorylation of signal transducer and activator of transcription (STAT) 5B. This triggers multiple downstream signalling pathways, including Raf‑MEK‑ERK, PI3K‑Akt, and STAT5.
-
In‑Vitro Binding Studies: Analytical size exclusion chromatography (SEC) has been validated to evaluate the in‑vitro binding capacity of somatropin to the soluble form and extracellular part of the human GHR, known as human growth hormone binding protein (hGHBp).
-
Functional Quality Assessment: In‑vitro techniques at the molecular and cellular levels can be applied to assess the functional quality of somatropin preparations, including size exclusion chromatography and other analytical methods.
Note: These effects have been documented in controlled laboratory settings. All HGH 191AA Somatropin supplied by Wuhan Top Miracle Peptides is intended strictly for research purposes and is not for human consumption.
HGH 191AA Somatropin Research Applications
HGH 191AA Somatropin is a versatile research tool applicable to several areas of laboratory investigation:
| Research Area | Relevant Mechanisms |
|---|---|
| Endocrine & Metabolic Studies | Investigating the GH/IGF‑1 axis, somatotroph function, and metabolic regulation in cellular and animal models |
| Receptor Binding & Signalling | Studying GHR binding kinetics, JAK2/STAT5 pathway activation, and signal transduction in growth‑responsive cells |
| Cellular Proliferation & Differentiation | Modelling the effects of GH on chondrocyte, myocyte, and hepatocyte proliferation and differentiation |
| Protein Quality Control | Validating the identity, purity, and functional integrity of recombinant protein preparations using SEC and other analytical methods |
| Endocrinology & Growth Research | Understanding the physiological and molecular mechanisms underlying linear growth, tissue repair, and metabolic homeostasis |
Wholesale Peptides for Sale – Fast, Discreet Worldwide Shipping
A reliable supply chain is essential for uninterrupted research. Our network allows us to serve labs across the globe efficiently.
-
United Kingdom – next‑day tracked delivery available (subject to Home Office and MHRA compliance)
-
France, Germany, Spain, Sweden, Italy and other EU countries – fully compliant and reliable shipping
-
United States of America – dependable delivery for American research institutions
For repeat‑order buyers and laboratory procurement teams, our wholesale program offers clear advantages:
-
Transparent, competitive bulk rates
-
A streamlined re‑ordering system that saves time and administrative burden
-
Discreet, fully tracked shipping on every single parcel
-
Dedicated account support for our regular wholesale customers
Understanding Peptide Purity for Your Application
All our HGH 191AA Somatropin lots meet the high‑purity standard necessary for serious laboratory work. We are fully transparent about all batch specifications.
| Purity Level | Best For | Typical Use Case |
|---|---|---|
| ≥98% (Standard) | Most general research | Reliable baseline studies, cost‑effective bulk orders |
| ≥99% (High) | Critical bioassays | High‑sensitivity work like receptor binding studies |
| ≥99.5% (Premium) | Extremely sensitive analyses | Advanced pharmacology, proteomic studies |
HGH 191AA Somatropin Storage and Handling Guidelines
To preserve the integrity of this recombinant protein:
-
Upon receipt, store the lyophilised powder at -20 °C for long‑term stability.
-
For short‑term storage (a few weeks), keep at 4 °C, protected from moisture and light.
-
After reconstitution, aliquot immediately to avoid repeated freeze‑thaw cycles, which can degrade the protein structure.
-
Avoid excessive shaking or vortexing, which can denature the polypeptide.
Frequently Asked Questions (FAQ) about HGH 191AA Somatropin
What is the molecular structure of HGH 191AA Somatropin?
HGH 191AA Somatropin is a recombinant human growth hormone consisting of a single, non‑glycosylated polypeptide chain of 191 amino acids with a molecular weight of approximately 22 kDa. Its amino acid sequence is identical to that of pituitary‑derived human growth hormone, and it contains two intrachain disulfide bridges at C53‑C165 and C182‑C189.
How does Somatropin exert its effects at the molecular level?
Somatropin binds to the growth hormone receptor (GHR) dimer on target cells. This binding induces a conformational change, activating Janus Kinase 2 (JAK2), which then phosphorylates signal transducer and activator of transcription (STAT) 5B. This triggers multiple downstream signalling pathways, including Raf‑MEK‑ERK, PI3K‑Akt, and STAT5, ultimately influencing cellular metabolism, proliferation, and differentiation.
What research applications is HGH 191AA Somatropin suitable for?
It is suitable for in‑vitro studies of the GH/IGF‑1 axis, GHR binding and signalling, cellular proliferation and differentiation, protein quality control using techniques such as size exclusion chromatography (SEC), and endocrine and metabolic research.
What is the legal status of purchasing HGH 191AA Somatropin in the United Kingdom?
Somatropin is a prescription-only medicine (POM) in the UK, regulated by the MHRA. It is legal to supply and purchase for legitimate research purposes under appropriate Home Office and MHRA authorisations, and when marketed as “For Research Use Only” (RUO), not for human consumption or medicinal claims. As an authentic licensed peptide seller, we hold the necessary licences to supply this compound exclusively for research applications.
Do you offer wholesale pricing for HGH 191AA Somatropin?
Yes. Wholesale is our core business. We serve universities, private research labs, and procurement teams worldwide. Please contact us directly for a custom quote tailored to your specific volume and frequency requirements.
What documentation do you provide with each HGH 191AA Somatropin order?
Every product we ship includes a batch‑specific Certificate of Analysis (COA). This document verifies the product’s identity, purity, and provides key analytical data, ensuring complete traceability for your research records. Independent third‑party testing confirms HPLC‑verified purity.
Is HGH 191AA Somatropin suitable for in‑vitro research?
Yes. It is designed for controlled in‑vitro models and laboratory research into endocrine signalling, receptor binding, cellular proliferation, and metabolic regulation. All products are supplied strictly for research applications.
MHRA medicine advertising guidance
Google Search Central helpful content guidance
ASA / CAP Code Section 12
Scientific reference source for HGH / somatropin
Professional Supply Regions
Wuhan Top Miracle Peptides supports wholesale and professional product enquiries across multiple regions.
Enquiry Regions
- United Kingdom
- France
- Germany
- Spain
- Sweden
- Italy
- USA
- Wider Europe
Add a note that shipping and supply depend on local laws, buyer qualification, product documentation, and regulatory requirements.
Secure Your High‑Purity Peptides for Sale Today
Your research deserves the best possible foundation. Don’t let variable reagent quality compromise your findings. Wuhan Top Miracle Peptides provides a reliable wholesale service for peptides for sale, backed by an unwavering commitment to purity, full documentation, and fast shipping across the UK, Europe, and the USA.
With verified HGH 191AA Somatropin ready for immediate dispatch (subject to appropriate Home Office and MHRA authorisations), you can advance your critical research without delay or compromise. All orders are handled with care, backed by complete Certificates of Analysis, and shipped discreetly in temperature‑controlled packaging.




Reviews
There are no reviews yet.