Skip to content
  • Each boxes of peptides contain 10 vials ...
  • Each boxes of peptides contain 10 vials ...
Wuhan Top Miracle PeptidesWuhan Top Miracle Peptides
    • Contact
    • 24 \ 24
    • +00 000 00 000
    • WhatsApp
  • Cart / €0.00 0
    • No products in the cart.

      Return to shop

  • 0
    Cart
  • HOME
  • SHOP
  • BULK ORDERS
  • SHIPPING & RETURNS
  • PRIVACY POLICY
  • FAQS
  • ABOUT US
  • REVIEWS
  • BLOG
  • CONTACT US
LL-37 (5mg) UK professional enquiry from Wuhan Top Miracle Peptides
Home / Peptides

LL-37 (5mg)

  • Matrixyl (200mg) UK supply from Wuhan Top Miracle Peptides

€78.00

LL-37 (5mg)

Buy Professional LL-37 (5mg) UK enquiry page. Request COA, batch documentation and compliant wholesale peptide supply support.

Category: Peptides Tags: Buy LL-37 online UK, CAMP peptide reference documentation, Cathelicidin research peptide, Cheap LL-37 UK, COA and batch review, Compliance-led supply discussion, LL-37 5mg UK documentation request, LL-37 antimicrobial peptide for use, LL-37 batch documentation, LL-37 before and after, LL-37 dosage, LL-37 for bacterial infection, LL-37 for gut health, LL-37 for immune support, LL-37 for infection, LL-37 for inflammation, LL-37 for Lyme disease, LL-37 for personal use, LL-37 for skin repair, LL-37 for viral infection, LL-37 for wound healing, LL-37 injection guide, LL-37 no prescription, LL-37 professional enquiry, LL-37 treatment UK, Peptide purity documentation, Professional peptide enquiry, research peptide supply UK, Verified buyer documentation, Wholesale peptide support
  • Matrixyl (200mg) UK supply from Wuhan Top Miracle Peptides
  • Description
  • Reviews (0)

LL-37 (5mg) Research Peptide: A Host Defense Peptide for Antimicrobial & Immunomodulation Studies

If your research investigates host defense peptides, innate immunity, or the molecular mechanisms of antimicrobial resistance, LL-37 (5mg) research peptide offers a precisely defined and extensively characterised synthetic tool. LL-37 is a 37‑amino‑acid cationic antimicrobial peptide and the sole member of the human cathelicidin family. It is derived from the C‑terminal end of the 18‑kDa hCAP‑18 proteinand exhibits a broad spectrum of antimicrobial activity against bacteria, fungi, and viruses. Beyond its direct antimicrobial effects, LL‑37 acts as a multifunctional host defense peptide that modulates innate immunity, promotes wound healing, and regulates inflammation. This makes LL-37 (5mg) research peptide a valuable tool for laboratories investigating infectious disease, immunology, and tissue repair.

At Wuhan Top Miracle Peptides, we supply high‑purity LL-37 (5mg) research peptide to research institutions and wholesale buyers across the United Kingdom, France, Germany, Spain, Sweden, Italy, and the USA. Every batch is lyophilised, HPLC‑verified to ≥98% purity, and accompanied by a Certificate of Analysis (COA), ensuring your investigations into host defense mechanisms, microbial pathogenesis, and tissue regeneration begin with uncompromising quality.

What Is LL‑37 and How Does It Work?

To fully appreciate the research potential of LL-37 (5mg) research peptide, it is essential to understand its biochemical structure and the mechanisms by which it exerts its pleiotropic effects.

The 37‑Amino‑Acid Cathelicidin‑Derived Peptide

LL‑37 is a 37‑residue, amphipathic, cationic peptide belonging to the cathelicidin family of host defense peptides. Its sequence is [LL-37, 37 aa] (one‑letter code). The peptide has a molecular formula of C₂₀₅H₃₄₀N₆₀O₅₃, a molecular weight of approximately 4493 Da, and a CAS number of 154947-66-7. It has a net charge of +6.

The peptide results from extracellular cleavage of the C‑terminal end of the 18‑kDa hCAP‑18 protein. Its amphipathic structure enables interaction with microbial membranes, while its cationic nature allows for electrostatic binding to negatively charged bacterial surfaces. The peptide can adopt mono‑, di‑, and tetrameric forms, supporting its functional versatility and stability.

Mechanism of Action: A Multifaceted Host Defense Peptide

The biological activity of LL-37 (5mg) research peptide is mediated through several distinct yet interconnected mechanisms:

Direct Antimicrobial Activity

The primary antimicrobial mechanism of LL‑37 involves disruption of microbial cell membranes through electrostatic interactions and pore formation. The peptide effectively combats over 38 bacteria, 16 fungi, and 16 viruses. Its mechanisms include:

  • Membrane Rupture: Disruption of microbial cell wall and membrane integrity

  • Biofilm Suppression: Inhibition of biofilm formation and disruption of established biofilms

  • Intracellular Targeting: Interference with cell cycle, gene modification, and oxidative stress pathways

  • Viral Inhibition: Disruption of viral envelopes, entry, and replication

LL‑37 has shown promise against drug‑resistant infections including MRSA, VRE, and resistant Klebsiella strains.

Immunomodulatory Activity

Beyond direct antimicrobial effects, LL‑37 modulates innate immunity through multiple pathways:

  • Endotoxin Neutralisation: Binds and inactivates lipopolysaccharide (LPS) and lipoteichoic acid

  • Immune Cell Chemotaxis: Promotes chemotaxis of immune cells to sites of infection

  • Cytokine Modulation: Exerts both anti‑ and pro‑inflammatory effects depending on context

  • Receptor Interaction: Interacts with plasma membrane receptors and mediates Ca²⁺ import

Wound Healing & Tissue Repair

LL‑37 plays a significant role in tissue repair and regeneration:

  • Angiogenesis: Upregulates VEGF to promote new blood vessel formation

  • Cell Migration & Proliferation: Induces cell migration, proliferation, and differentiation

  • Platelet Activation: Promotes platelet activation and thrombus formation during hemostasis

Key Research Applications for LL‑37 (5mg)

LL-37 (5mg) research peptide is a versatile tool with applications spanning several domains of biomedical research.

1. Antimicrobial & Infectious Disease Research

LL‑37’s broad‑spectrum activity against bacteria, fungi, and viruses makes it a valuable tool for studying host‑pathogen interactions. Research applications include:

  • Antibiotic Resistance Models: Investigating LL‑37’s efficacy against drug‑resistant strains such as MRSA, VRE, and resistant Klebsiella

  • Biofilm Studies: Exploring the peptide’s ability to prevent biofilm formation and disrupt established biofilms

  • Viral Inhibition: Studying LL‑37’s mechanisms of antiviral activity, including disruption of viral envelopes and replication

  • Synergistic Combinations: Investigating LL‑37 in combination with existing antibiotics

2. Immunology & Inflammation Research

LL‑37’s dual anti‑ and pro‑inflammatory properties position it as a key tool for immunology research:

  • Endotoxin Neutralisation: Studying how LL‑37 binds and inactivates LPS and lipoteichoic acid

  • Immune Cell Signalling: Investigating LL‑37’s interaction with plasma membrane receptors and Ca²⁺ signalling

  • Cytokine Networks: Exploring the peptide’s role in modulating inflammatory responses

  • Autoimmune & Inflammatory Disease: Studying LL‑37’s involvement in conditions such as psoriasis and periodontitis

3. Wound Healing & Tissue Repair Research

LL‑37 promotes angiogenesis, cell migration, and proliferation, making it a valuable tool for tissue repair research:

  • Angiogenesis Studies: Investigating LL‑37’s upregulation of VEGF and its role in new blood vessel formation

  • Chronic Wound Models: Exploring LL‑37’s efficacy in diabetic wound healing and other chronic wound models

  • Skin & Corneal Repair: Studying LL‑37’s role in protecting the cornea and modulating wound healing

  • Scaffold & Delivery Systems: Investigating LL‑37 in combination with biomaterials for tissue engineering

4. Cancer & Amyloid Research

Emerging research has explored LL‑37’s anti‑cancer and anti‑amyloidogenic properties:

  • Cancer Cell Cytotoxicity: Investigating LL‑37’s preferential killing of infected and cancer cells

  • Amyloid‑Related Diseases: Studying LL‑37’s influence on amyloid‑related diseases

  • Gut‑Brain Axis: Exploring LL‑37’s role in mucosal immunity and neuroinflammation

Chemical & Physical Specifications for LL-37 (5mg)

Accurate characterisation of LL-37 (5mg) research peptide is essential for reproducible experimental design.

Parameter Specification
Common Names LL‑37, Human Cathelicidin, hCAP‑18 Fragment
Amino Acid Sequence (One‑Letter) [LL-37, 37 aa]
Amino Acid Sequence (Three‑Letter) Leu‑Leu‑Gly‑Asp‑Phe‑Phe‑Arg‑Lys‑Ser‑Lys‑Glu‑Lys‑Ile‑Gly‑Lys‑Glu‑Phe‑Lys‑Arg‑Ile‑Val‑Gln‑Arg‑Ile‑Lys‑Asp‑Phe‑Leu‑Arg‑Asn‑Leu‑Val‑Pro‑Arg‑Thr‑Glu‑Ser
Molecular Formula C₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight ~4493 Da
CAS Number 154947‑66‑7
Net Charge +6
Purity ≥98% (HPLC verified)
Appearance White to off‑white lyophilised powder
Solubility Soluble in sterile water and sterile PBS (pH 5‑7)
Storage (Lyophilised) –20°C, sealed, protected from light; stable for up to 2 years
Storage (Reconstituted) 2‑8°C for short‑term use; single‑use aliquots at –20°C for long‑term storage

Note: The 5 mg mass refers to the weight of the peptide in its lyophilised form. LL‑37 is typically supplied as a TFA or acetate salt. The peptide should be stored protected from moisture and light, preferably under nitrogen for long‑term storage.

Reconstitution & Handling Protocol for LL‑37 (5mg)

Proper reconstitution of LL-37 (5mg) research peptide is critical for maintaining its structural integrity and biological activity. LL‑37 is susceptible to proteolytic degradation, so careful handling is essential.

Step 1 – Preparation

  • Bring the sealed LL‑37 vial and your chosen diluent (sterile bacteriostatic water or sterile PBS, pH 5‑7) to room temperature. Condensation can degrade the lyophilised powder.

  • Clean your work surface with 70% ethanol and lay out sterile syringes, alcohol wipes and a clean work mat.

Step 2 – Vial Sanitisation

  • Wipe the rubber stopper of the LL‑37 vial with a fresh 70% ethanol wipe. Allow the alcohol to evaporate completely before piercing.

Step 3 – Reconstitution

  • Draw your desired volume of diluent into a sterile syringe. A common starting concentration for research applications is 5 mg per 0.5 mL of diluent, yielding a 10 mg/mL stock solution.

  • Insert the needle and slowly inject the diluent against the inner glass wall. Do not spray directly onto the lyophilised powder.

  • Gently swirl the vial until the solution is clear and fully dissolved. Do not shake vigorously, as shaking can cause denaturation.

Step 4 – Aliquoting & Storage

  • Immediately after dissolution, aliquot the reconstituted LL‑37 into single‑use sterile vials.

  • Store aliquots at –20°C. Avoid repeated freeze‑thaw cycles, as peptides are susceptible to degradation.

  • Once thawed, store at 2‑8°C and use within a short period.

Concentration Reference Table for LL-37 (5mg)

Vial Mass Diluent Volume Final Concentration
5 mg 0.5 mL 10 mg/mL
5 mg 1.0 mL 5 mg/mL
5 mg 2.5 mL 2 mg/mL

Adjust diluent volume based on your experimental requirements. For cell culture applications, typical working concentrations range from 1‑10 µM, though higher concentrations (up to 300 µM) have been reported in some research models.

Storage & Stability Guidelines for LL-37 (5mg)

Storage Condition Shelf Life Notes
Lyophilised at –20°C, unopened 2 years Use desiccant, protect from light and moisture
Lyophilised at 2‑8°C, unopened 6‑12 months –20°C storage is strongly preferred for long‑term stability
Reconstituted at 2‑8°C Short‑term use Use within days to weeks
Reconstituted aliquots at –20°C Up to 3 months Single freeze only; discard after thawing
Reconstituted aliquots at –80°C Up to 6 months Recommended for long‑term storage

Why Choose Wuhan Top Miracle Peptides for LL‑37 (5mg)?

As an authentic licensed peptide supplier based in the United Kingdom, we supply LL-37 (5mg) research peptide and a wide range of research‑grade compounds under rigorous quality assurance protocols, fully aligned with Google’s E‑E‑A‑T standards (Experience, Expertise, Authoritativeness, Trustworthiness).

  • Verified Purity: Independent HPLC analysis with purity guaranteed ≥98% for every batch.

  • GMP‑Compliant Manufacturing: All peptides are synthesised under strict quality control conditions.

  • Full Traceability: Batch‑specific Certificates of Analysis (COA) are available for every order.

  • Wholesale Supply: We serve research institutions, laboratories, and wholesale buyers across the UK, EU, and USA with flexible volume pricing and reliable logistics.

  • UK‑Based Regulatory Compliance: All products are supplied strictly as research‑grade chemicals for laboratory use only (RUO).

Researchers across the United Kingdom—including those at leading institutions in London, Cambridge, Oxford, Manchester, and Edinburgh—trust us for fast domestic delivery, transparent documentation and professional technical support.

FAQ: LL‑37 (5mg) Research Peptide

What is LL‑37 (5mg) research peptide?
LL‑37 is a 37‑amino‑acid cationic antimicrobial peptide and the sole member of the human cathelicidin family. It is derived from the C‑terminal end of the hCAP‑18 proteinand exhibits broad‑spectrum antimicrobial, immunomodulatory, and wound‑healing activities.

What is the sequence and molecular weight of LL‑37?
The sequence is [LL-37, 37 aa] Its molecular weight is approximately 4493 Da.

What are the primary research applications for LL‑37?
LL‑37 is used in antimicrobial and infectious disease research (including drug‑resistant strains), immunology and inflammation research, wound healing and tissue repair studies, and cancer and amyloid research.

What is the mechanism of action of LL‑37?
LL‑37 acts through multiple mechanisms: direct membrane disruption of microbes, immunomodulation via endotoxin neutralisation and cytokine modulation, and promotion of angiogenesis, cell migration, and proliferation.

What purity does your LL‑37 (5mg) meet?
Our LL‑37 is tested to ≥98% purity by HPLC. A Certificate of Analysis (COA) is supplied with every order.

How should I reconstitute LL‑37 (5mg)?
Reconstitute with sterile bacteriostatic water or sterile PBS (pH 5‑7). Allow the vial to reach room temperature, then slowly inject the diluent against the inner glass wall and swirl gently. Do not shake.

How should I store reconstituted LL‑37?
Reconstituted LL‑37 should be stored at 2‑8°C for short‑term use. For longer storage, aliquot immediately into single‑use vials and store at –20°C for up to 3 months or at –80°C for up to 6 months. Avoid repeated freeze‑thaw cycles.

Is LL‑37 research peptide legal to purchase in the UK?
Yes. LL‑37 is a laboratory reagent sold for research use only (RUO). It is fully legal to purchase, possess, and use in the United Kingdom for legitimate in‑vitro or in‑vivo scientific research, provided it is not marketed with therapeutic claims.

Does Wuhan Top Miracle Peptides ship internationally?
Yes. We ship across the EU (France, Germany, Spain, Sweden, Italy) and to the USA from our UK warehouse. Wholesale pricing is available for bulk orders.

Wholesale LL-37 5mg Supply Across the UK and Europe

Wuhan Top Miracle Peptides supports wholesale peptide buyers in the United Kingdom and international markets.

We Support Enquiries From:

  • United Kingdom
  • France
  • Germany
  • Spain
  • Sweden
  • Italy
  • USA
  • Wider Europe

For larger LL-37 5mg enquiries, contact our team before ordering. This helps confirm stock, documentation, shipping options, product identity, and buyer verification requirements.

Where to Source LL-37 5mg in the UK

If you are searching for where to source LL-37 (5mg) in the UK, Wuhan Top Miracle Peptides provides a simple professional enquiry process.

Professional Enquiry Process

  1. Review the LL-37 (5mg) product details.
  2. Check the current label and batch information.
  3. Confirm whether the batch is listed as LL-37, LL37, cathelicidin peptide, CAMP peptide, or another verified identity.
  4. Ask about COA and purity-related documentation.
  5. Confirm the sequence and salt form where required.
  6. Confirm your shipping country.
  7. Discuss wholesale quantity requirements.
  8. Complete buyer verification where required.
  9. Place a professional enquiry with support from our team.

 

Bulk Peptides Page
Shipping & Returns Page
Contact Us Page
Shop Page
Quality / Compliance Page
NCBI Gene / CAMP reference
Scientific or peer-reviewed reference source
GOV.UK / MHRA
Google Search Central
ASA / CAP Code Section 12

From its discovery as the sole human cathelicidin to its well‑characterised role as a multifunctional host defense peptide, LL-37 (5mg) research peptide provides a precisely defined and increasingly valuable platform for advanced antimicrobial and immunology research. Its ability to combat over 38 bacteria, 16 fungi, and 16 viruses, modulate innate immunity, and promote wound healing—supported by a growing body of peer‑reviewed literature published in ScienceDirect, PubMed, and other authoritative journals—makes it a valuable addition to any laboratory investigating host‑pathogen interactions, innate immunity, or tissue repair. By choosing high‑purity, lab‑verified LL-37 (5mg) research peptide from Wuhan Top Miracle Peptides, you ensure that your research is built on a foundation of quality, reproducibility, and scientific integrity.

Ready to advance your research with LL‑37 (5mg)? Browse our product catalogue, request a wholesale quote, or contact our support team today to discuss your laboratory’s specific needs. Place your order now and receive GMP‑grade LL‑37 delivered directly to your facility in the UK, EU, or USA.

Reviews

There are no reviews yet.

Be the first to review “LL-37 (5mg)” Cancel reply

Related products

Cardiogen (20mg) UK professional enquiry from Wuhan Top Miracle Peptides
Quick View

Peptides

Cardiogen (20mg)

€65.00
Add to cart
AHK-Cu (200mg)
Quick View

Peptides

AHK-Cu (200mg)

€195.00
Add to cart
ACE-031 (1mg)
Quick View

Peptides

ACE-031 (1mg)

€150.00
Add to cart
Chonluten (20mg) UK professional enquiry from Wuhan Top Miracle Peptides
Quick View

Peptides

Chonluten (20mg)

€50.00
Add to cart
Muscle Peptide 185 For Anabolic Strength (84 Capsules) UK professional enquiry from Wuhan Top Miracle Peptides
Quick View

Peptides

Muscle Peptide 185 For Anabolic Strength (84 Capsules)

€55.00
Add to cart
BPC-157 & TB-500 Blend (10mg/20mg) wholesale peptide supply UK
Quick View

Peptides

BPC-157 & TB-500 Blend (10mg/20mg)

€100.00
Add to cart
Acetyl Hexapeptide-3 (Argireline) peptide documentation support for UK and Europe buyers
Quick View

Mini Insulin Fridges

Acetyl Hexapeptide-3 (Argireline)

€195.00
Add to cart
BPC-157 & TB-500 & GHK-Cu Blend wholesale peptide blend supply UK
Quick View

Peptides

BPC-157 & TB-500 & GHK-Cu Blend

€220.00
Add to cart
About Us

We are Wuhan Top Miracle Peptides, a fully licensed and UK‑based wholesaler of high‑purity research peptides. From our hub in the United Kingdom, we serve laboratories, research institutions, and biotech companies across Europe – including Spain, Germany, France, Ireland, and beyond.

Recent Posts
  • Buy KLOW
  • Buy GHK-CU
  • BPC-157 & TB-500 & GHK-Cu Blend
  • Buy BPC + TB
  • where to buy peptides in uk
Contact Info

Visit Wuhan Top Miracle Peptides today to contact our team, request wholesale information, and learn more about our peptide supply services across Europe.

info@wuhantopmiraclepeptides.com

https://wuhantopmiraclepeptides

whatsapp  447735045662

 

Copyright 2026 © wuhan top miracle peptides
  • HOME
  • SHOP
  • BULK ORDERS
  • SHIPPING & RETURNS
  • PRIVACY POLICY
  • FAQS
  • ABOUT US
  • REVIEWS
  • BLOG
  • CONTACT US
  • Login
  • Newsletter

Login

Lost your password?

WhatsApp us